SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022515 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022515
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 2.09e-16
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022515   Gene: ENSGGOG00000008521   Transcript: ENSGGOT00000029493
Sequence length 269
Comment pep:known_by_projection chromosome:gorGor3.1:3:195812944:195815034:1 gene:ENSGGOG00000008521 transcript:ENSGGOT00000029493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPTPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSN
SGTSVGPNAVSPSSGPSLTADSMWRPWRN
Download sequence
Identical sequences ENSGGOP00000022515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]