SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022527 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022527
Domain Number 1 Region: 367-528
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-46
Family Phosphotyrosine-binding domain (PTB) 0.000000736
Further Details:      
 
Domain Number 2 Region: 675-731
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000158
Family PDZ domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022527   Gene: ENSGGOG00000005676   Transcript: ENSGGOT00000031891
Sequence length 735
Comment pep:known_by_projection chromosome:gorGor3.1:15:7514574:7574008:1 gene:ENSGGOG00000005676 transcript:ENSGGOT00000031891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAMAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPA
PEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCN
GEEYLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEA
HDQEEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSL
SMTSITSASEASPEHGPEPGPEDSAEACPPIKAGCSPSRQEARPKSLNLLPEAKHPGDPQ
RGFKPKTRTPEERPKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAV
PGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKA
NSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPR
SASQDCIETTPGAQEGKKQYKMICHVFESEDKAHLHMRLSSAFACGLQRKLILLTDQQEA
LLVSQFCGCCQSEILKNDLDLGNREGSPYCHDHDIQHSTPGPCPGVCLAEVHWGSTAQIW
VLVCRRGGGPLTAVCVCTCVYTHVCLGQVSLCFSHPRPLASSQGSAQSPFSRTRTSMFGT
ECPYVTCVVEQRPHLSGGQGTGCLSFPICSLMRGGIAERGGVRVGHRIIEINGQSVVATA
HEKIVQALSNSVGEV
Download sequence
Identical sequences ENSGGOP00000022527 ENSGGOP00000005558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]