SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022531
Domain Number 1 Region: 475-820
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.57e-113
Family Rap/Ran-GAP 0.000000534
Further Details:      
 
Domain Number 2 Region: 944-1024
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000593
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022531   Gene: ENSGGOG00000006506   Transcript: ENSGGOT00000023507
Sequence length 1765
Comment pep:known_by_projection chromosome:gorGor3.1:19:35450381:35579263:1 gene:ENSGGOG00000006506 transcript:ENSGGOT00000023507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYRAIPSDGVDLAASCGARAGDVLPGPHTGDYAPLGFWAQNGSMSQPLGESPPAMPKM
GVRARVADWPPKREALREHSNPSPSQDTDGTKATKMAHSMRSIQNGQPPTSTPASSGSKA
FHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECDAEDAGEPRGARHTGALP
LFREYGSTSSIDVQGMPEQSFFDILNEFRSEQPDARGCQALTELLRADPGPHLMGGGGGA
KGDSHNGQLAKDSLLPLQPTKEKEKARKKPARGLGGGDTVDSSIFRKLRSSKPEGEAGRS
PGEADEGRSPPEASRPWVCQKSFAHFDVQSMLFDLNEAAANRVSVSQRRNTTTGASAASA
ASAMASLTASRAHSLGGLDPAFTSTEDLNCKENLEQDLGDDNSNDLLLSCPHFRNEIGGE
CERNVSFSRASVGSPSSGEGHLAEPALSAYRTNASISVLEVPKEQQRTQSRPRQYSIEHV
DLGARYYQDYFVGKEHANYFGVDEKLGPVAVSIKREKLEDHKEHGPQYQYRIIFRTRELI
TLRGSILEDATPTATKHGTGRGLPLKDALEYVIPELNIHCLRLALNTPKVTEQLLKLDEQ
GLCRKHKVGILYCKAGQSSEEEMYNNEEAGPAFEEFLSLIGEKVCLKGFTKYAARVSVST
DSTGTHSLYTMYQDYEIMFHVSTLLPYTPNNRQQLLRKRHIGNDIVTIIFQEPGALPFTP
KNIRSHFQHVFIIVRVHNPCTDNVCYSMAVTRSKDAPPFGPPIPSGTTFRKSDVFRDFLL
AKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCVSNTPIDSTGKFNLISLTSKKKEKT
KARAGAEQHSAGAIAWRVAAQDYAQGVEIDCILGISNEFVVLLDLRTKEVVFNCYCGDVI
GWTPDSSTLKIFYGRGDHIFLQATEGSVEDIREIVQRLKVMTNGWETVDMTLRRNGLGQL
GFHVKYDGTVAEVEDYGFAWQAGLRQGSRLVEICKVAVVTLTHDQMIDLLRTSVTVKVVI
IPPFEDGTPRRGWPETYDMNTSEPKTEQESITPGGRPPYRSNAPWQWSGPASHNSLPASK
WATPTTPGHAQSLSRPLKQTPIVPFRESQPLHSKRPVSFPETPYTVSPAGADRVPPYRQP
SGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMER
QKPEPLWHVPAQARLSAIAGSSGNKHPSRQDAAGKDSPNRHSKGEPQYSSHSSSNTLSSN
ASSSHSDDRWFDPLDPLEPEQDPLSKGGSSDSGIDTTLYNSSPSCMSLAKAPRPTKPHKP
PGSMGLCGGGREAAGRSHHTDHRRREVSPAPAVAGQSKGYRPKLYSSGSSTPTGLAGGSR
DPPRQPSDMGSRVGYPAQVYKTASAETPRPSQLAQPSPFQLSASVPKSFFSKQPVRNKHP
TGWKRTEEPPPRPLPFSDPKKQVDTNTKNVFGQPRLRASLRDLRSPRKNYKSTIEDDLKK
LIIMDNLGPEQERDAGQSPQKGLQRTLSDESLCSGRREPSFASPAGLEPGLPSDVLFTST
CAFPSSTLPARRQHQHPHAPVGPGATPAAGSGFPEKKSTISASELSLADGRDRPLRRLDP
GMMPLPDTAAGLEWSSLVNAAKAYEVQRAVSLFSLNDPALSPDIPPAHSPVHSHLSLERG
PPTPRTTPTMSEELPLDLTGKVYQLEVMLKQLHTDLQKEKQDKVVLQSEVASLRQNNQRL
QEESQAASEQLRKFAEIFCREKKEL
Download sequence
Identical sequences ENSGGOP00000022531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]