SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022551 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022551
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000129
Family HtrA-like serine proteases 0.052
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000315
Family HtrA-like serine proteases 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022551   Gene: ENSGGOG00000024764   Transcript: ENSGGOT00000026036
Sequence length 440
Comment pep:known_by_projection chromosome:gorGor3.1:3:40165908:40176939:-1 gene:ENSGGOG00000024764 transcript:ENSGGOT00000026036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLK
ANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEP
SSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTP
NAAWGGEGSLGCGIGYGYLHRIPTQPPSYHKKPPGTPPPSAPPLGAPPPDALPPGPSPED
SPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ
RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEAT
WSGSEFEVSFMDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG
LDTGTEAEGLDSQAQISTTE
Download sequence
Identical sequences A0A2I2YV97
ENSGGOP00000022551 XP_004033923.1.27298 ENSGGOP00000022551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]