SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022626 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022626
Domain Number 1 Region: 126-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.01e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 37-102
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 415-468
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000303
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022626   Gene: ENSGGOG00000001083   Transcript: ENSGGOT00000027461
Sequence length 473
Comment pep:known_by_projection chromosome:gorGor3.1:19:1549173:1561249:-1 gene:ENSGGOG00000001083 transcript:ENSGGOT00000027461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKAL
RAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGTAQ
GPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPE
NVDRAREEIEAHITLRTGAFTDAGPDSDFHANGTDVCLDLLGAAASLWAKTPNPGRRPPT
ATAGLRGDTALGAPSAPEAFYAGSRGGAEGPGAPVGTAAPDDCDFGFDFLALDLTVPAAA
TIWAPFERAAPLPAFSGCSTVNGAPGPSGAGTPRHSPTLPEPGGLRLELPLSRRGAPDPV
GALSWRPPQGPVSFPGGAAFSTATSLPSSPAAAACAPLDSGASENNRKPPSASSAPALAR
ECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIHIFS
Download sequence
Identical sequences ENSGGOP00000022626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]