SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022632 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022632
Domain Number 1 Region: 318-490,534-707
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.38e-130
Family Mammalian PLC 0.00000000257
Further Details:      
 
Domain Number 2 Region: 945-1204
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 4.18e-63
Family C-terminal domain of PLC-beta 0.00033
Further Details:      
 
Domain Number 3 Region: 148-314
Classification Level Classification E-value
Superfamily EF-hand 8.35e-51
Family EF-hand modules in multidomain proteins 0.00000954
Further Details:      
 
Domain Number 4 Region: 17-146
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-43
Family Pleckstrin-homology domain (PH domain) 0.0000301
Further Details:      
 
Domain Number 5 Region: 728-841
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-23
Family PLC-like (P variant) 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022632   Gene: ENSGGOG00000012218   Transcript: ENSGGOT00000028303
Sequence length 1240
Comment pep:known_by_projection chromosome:gorGor3.1:11:61063664:61079569:1 gene:ENSGGOG00000012218 transcript:ENSGGOT00000028303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
SGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRGWAAGRHPTTLSSSSSQGLCSSGQRDDLIASILSEVAPTPL
DELRGHKALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGG
AADVEDTKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLD
ANTTQFKRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVN
SIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGE
MPEGLGDGPLVACASNGHAPGSSGHLSGADSESQEENTQL
Download sequence
Identical sequences ENSGGOP00000022632 ENSGGOP00000011943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]