SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022637 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022637
Domain Number 1 Region: 46-216
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-30
Family C-type lectin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022637   Gene: ENSGGOG00000005970   Transcript: ENSGGOT00000030754
Sequence length 225
Comment pep:known_by_projection chromosome:gorGor3.1:12:9646453:9659121:-1 gene:ENSGGOG00000005970 transcript:ENSGGOT00000030754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQQVIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQVREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELTHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSYLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Download sequence
Identical sequences G3QT32
XP_004052724.1.27298 ENSGGOP00000005839 ENSGGOP00000022637 ENSGGOP00000005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]