SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022638 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022638
Domain Number 1 Region: 27-216
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.06e-56
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000000179
Further Details:      
 
Domain Number 2 Region: 216-314
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.28e-31
Family HCDH C-domain-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022638   Gene: ENSGGOG00000004423   Transcript: ENSGGOT00000025118
Sequence length 315
Comment pep:known_by_projection chromosome:gorGor3.1:4:117357270:117400725:1 gene:ENSGGOG00000004423 transcript:ENSGGOT00000025118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAFVTRQFMRSMSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQT
EDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEA
IVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFGGLHFFNPVPVMK
LVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDA
SKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDTENPLHQPSPSLNKLVAE
NKFGKKTGEGFYKYK
Download sequence
Identical sequences ENSGGOP00000022638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]