SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022661 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022661
Domain Number 1 Region: 108-253,295-317,344-409
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 3.61e-18
Family Methylamine dehydrogenase, H-chain 0.083
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily F-box domain 1.07e-17
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022661   Gene: ENSGGOG00000022457   Transcript: ENSGGOT00000025916
Sequence length 464
Comment pep:known_by_projection chromosome:gorGor3.1:3:49612775:49635374:1 gene:ENSGGOG00000022457 transcript:ENSGGOT00000025916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIRLPDLALKRIFSFLDLFGLLQVSQVNKHWNRIADSDYLWRSLSLQRWDCSNFTNQHL
GTHTWKQFFLHQRRKELQLALAQPHNFVYKVTKNIAFETELAYLSGNRLTVDEQEKSIIC
SVSPKQELCAWDVQEGTMIWSSPVQEFHFSNLVTLPQMHLAITMDRKKTIKVWNCQDRDA
LAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDISKVTAFQYGIVLLHCS
PDKKWVFACGTYSRTLPQVFLTESLLRPSEGSAPLSTFLPHKLCASACWTPKVKNRITLM
SQSSTGKKTEFITFDITTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYMIVFTSG
PYLLLFSITGFLLQRFEDHQAAINNFWVDPCYVLTTSENSVHVYMWEEGGRHPYLRSCCH
LENTWHDHTTDSCISSVMCDNASIVLTVTKVSDSSILVMYSLNT
Download sequence
Identical sequences G3S3L1
ENSGGOP00000019201 ENSGGOP00000022661 XP_004034117.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]