SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022679 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022679
Domain Number 1 Region: 14-202
Classification Level Classification E-value
Superfamily PR-1-like 1.07e-37
Family PR-1-like 0.00029
Further Details:      
 
Domain Number 2 Region: 304-446
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-25
Family C-type lectin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022679   Gene: ENSGGOG00000024801   Transcript: ENSGGOT00000022763
Sequence length 456
Comment pep:novel chromosome:gorGor3.1:16:60154532:60167755:1 gene:ENSGGOG00000024801 transcript:ENSGGOT00000022763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHPETSPGWGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLDWSDDSLAQLAQARAALCGTPTPSLASGPWRTLQVGWNVQLLPAGLAS
FVEVVSLWFAEGQRYSHTAGECAHNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFV
CAYSPGGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNH
GRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPF
HTCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEV
IDSDFETTNFWIGLTYKTAKDSFRWATGEHQAFTSFAFEQPDNHGLVWLSAAMGFGNCME
LQASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS
Download sequence
Identical sequences G3S3M9
ENSGGOP00000022679 ENSGGOP00000025450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]