SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022682 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022682
Domain Number 1 Region: 20-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-43
Family Pentraxin (pentaxin) 0.00000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022682   Gene: ENSGGOG00000025795   Transcript: ENSGGOT00000026630
Sequence length 224
Comment pep:known_by_projection chromosome:gorGor3.1:1:138717482:138719786:-1 gene:ENSGGOG00000025795 transcript:ENSGGOT00000026630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKGIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEESQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVRGEVFTKPQLWP
Download sequence
Identical sequences G3S3N2
ENSGGOP00000022682 XP_004027118.1.27298 ENSGGOP00000022682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]