SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022686 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022686
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily t-snare proteins 3.34e-27
Family t-snare proteins 0.00000267
Further Details:      
 
Domain Number 2 Region: 164-231
Classification Level Classification E-value
Superfamily SNARE fusion complex 6.8e-16
Family SNARE fusion complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022686   Gene: ENSGGOG00000000732   Transcript: ENSGGOT00000024700
Sequence length 261
Comment pep:known_by_projection chromosome:gorGor3.1:1:160478915:160511003:-1 gene:ENSGGOG00000000732 transcript:ENSGGOT00000024700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVCEEPSVGMMVAEEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIE
WDLEDLDETINILFCVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALA
ERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQQLIVEQQDEQLE
LVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQ
WCAIAILFAVLLVVLILFLVL
Download sequence
Identical sequences ENSGGOP00000022686 ENSGGOP00000022686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]