SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022688 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022688
Domain Number 1 Region: 265-379
Classification Level Classification E-value
Superfamily PH domain-like 1.3e-32
Family Pleckstrin-homology domain (PH domain) 0.0000772
Further Details:      
 
Domain Number 2 Region: 522-625
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-25
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 33-81
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.000000000127
Family Adapter protein APS, dimerisation domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022688   Gene: ENSGGOG00000008472   Transcript: ENSGGOT00000022857
Sequence length 754
Comment pep:known_by_projection chromosome:gorGor3.1:16:29717985:29726469:1 gene:ENSGGOG00000008472 transcript:ENSGGOT00000022857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGAPKPSTAGSKAKESSPSPPPGAHHEWCPFPRGRGLPFARRFRLYLASHPQYAGPGAEA
AFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVVGPLAVLGP
SRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPSSA
GPLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGALKD
GAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGG
GSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYILETVDAQ
HVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQD
LLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGP
PAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLVL
TGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLE
HFRVHPIPLESGGSSDVVLVSYVPSSQRQQEPNTSHDPPQPPEPPSWTDPPQPGAEEASR
APEVAAAAAAAAKERQEKEKAGGGGVPEELVPVVELVPVVELEEAIAPGSEAQGAGSGGD
AGLPPMVQLQQSPLGGDREEGGHPRAINNQYSFV
Download sequence
Identical sequences ENSGGOP00000022688 ENSGGOP00000022688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]