SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022690 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022690
Domain Number 1 Region: 48-336
Classification Level Classification E-value
Superfamily HAD-like 9.7e-80
Family Pyrimidine 5'-nucleotidase (UMPH-1) 0.000000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022690   Gene: ENSGGOG00000028164   Transcript: ENSGGOT00000033828
Sequence length 336
Comment pep:known_by_projection chromosome:gorGor3.1:7:33495729:33544310:-1 gene:ENSGGOG00000028164 transcript:ENSGGOT00000033828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMLSQKKKTSY
RIYGLNRRQSFLCGIMMNGMRKFNIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLR
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Download sequence
Identical sequences ENSGGOP00000022690 ENSGGOP00000022690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]