SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022705 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022705
Domain Number 1 Region: 322-486
Classification Level Classification E-value
Superfamily Folate-binding domain 1.88e-40
Family Aminomethyltransferase folate-binding domain 0.00056
Further Details:      
 
Domain Number 2 Region: 3-182,287-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-31
Family FAD-linked reductases, N-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 184-286
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.61e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 4 Region: 488-581
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000123
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022705   Gene: ENSGGOG00000009314   Transcript: ENSGGOT00000031771
Sequence length 602
Comment pep:known_by_projection chromosome:gorGor3.1:16:60325736:60354406:1 gene:ENSGGOG00000009314 transcript:ENSGGOT00000031771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAGSTRFCAGILSTARHLTIEQKMADYSNKLYHQLEQETGIQTGYTRTGSIFLAQTQDR
LISLKRINAGLNVIGIPSEIISPKKVAGLHHLLNVHDLVGAMHVPEDAVVSSADVALALA
SAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPV
SIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEG
KNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQ
GYFVLAGMNSAGLSFGGGAGSTGDQALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYEND
CSIARLNRRSFFMISPTDQQVHCWAWLKKHMPKDSNLLLEDVTWKYTYALHVYNEVMSVG
QKYGIRNAGYYALRSLRIEKFFAFWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQ
QKQNGVYKRLTMFILDDHDTDLDLWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFV
HNFSEDTGEEQVVTADFINRGEYEIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLH
GK
Download sequence
Identical sequences ENSGGOP00000022705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]