SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022734 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022734
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.61e-119
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000000117
Further Details:      
 
Domain Number 2 Region: 261-379
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.83e-48
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022734   Gene: ENSGGOG00000024015   Transcript: ENSGGOT00000030288
Sequence length 380
Comment pep:known chromosome:gorGor3.1:MT:14171:15311:1 gene:ENSGGOG00000024015 transcript:ENSGGOT00000030288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPMRKTNPLAKLINHSFIDLPTPSNISTWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWTIRYLHANGASMFFICLFLHIGRGLYYGSFLHQETWNIGIILL
LTTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWVWGGYSVDSPTLTRFFT
FHFILPFIITALTTLHLLFLHETGSNNPLGIPSHSDKITFHPYYTIKDILGLFFFLLTLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALLLSILI
LTMIPILHMSKQQSMMFRPLSQLLYWFLIANLFTLTWIGGQPVSYPFITIGQVASVLYFT
TILFLMPITSLIENKMLKWT
Download sequence
Identical sequences G3S3T4
ENSGGOP00000022734 YP_002120670.1.27298 ENSGGOP00000022734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]