SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022735 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022735
Domain Number 1 Region: 6-580
Classification Level Classification E-value
Superfamily ARM repeat 4.25e-150
Family Clathrin adaptor core protein 0.00000000000000835
Further Details:      
 
Domain Number 2 Region: 837-949
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 8.44e-52
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.00000047
Further Details:      
 
Domain Number 3 Region: 721-835
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.2e-30
Family Alpha-adaptin ear subdomain-like 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022735   Gene: ENSGGOG00000015593   Transcript: ENSGGOT00000030067
Sequence length 949
Comment pep:known_by_projection chromosome:gorGor3.1:5:48349953:48487346:-1 gene:ENSGGOG00000015593 transcript:ENSGGOT00000030067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGEAP
SLYIKVHTYLNKTAGVFLFLFSLGGGLKMQPLKNWQVAVKNNIDVFYFSCLIPLNVLFVE
DGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLY
QSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Download sequence
Identical sequences ENSGGOP00000015220 ENSGGOP00000022735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]