SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022740 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022740
Domain Number 1 Region: 557-812
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.12e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 40-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-73
Family Eukaryotic proteases 0.00067
Further Details:      
 
Domain Number 3 Region: 432-530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 852-944
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000102
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number 5 Region: 982-1049
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000536
Family Spermadhesin, CUB domain 0.009
Further Details:      
 
Domain Number 6 Region: 333-410
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000301
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022740   Gene: ENSGGOG00000008697   Transcript: ENSGGOT00000026021
Sequence length 1054
Comment pep:known_by_projection chromosome:gorGor3.1:12:29828839:29885175:-1 gene:ENSGGOG00000008697 transcript:ENSGGOT00000026021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLASAGLLLLLVIGHPRSLGLKCGICMVNMKSKETAVGSRFFSRISSWRNSTVTGHPW
QVSLKSDEHRFCGGSLIQEDRVVTAAHCLDSLSEKQLKNITVTSGEYSLFQKDKQEQNIP
VSKIITHPEYNSREYMSPDIALLYLKHKVKFGNAVQPICLPDSDDKVEPGILCLSSGWGK
ISKTSEYSNVLQEMELPIMDDRACNTVLKSMNLPPLGRTMLCAGFPDGGMDACQGDSGGP
LVCRRGGGIWILAGITSWVAGCAGGSAPIRNNHVKASLGIFSKVSELMDFITQNLLTGLD
WGQPLSKVGPKCITKALSSVQEVNGRQRGEGILDMEKQVGCDHDYVSLRSSSGVLFNQRS
LMEDDGKQNKHVCGKILPSPLLAETSEAMVPFVSDTEDSGSGLELTFTAVQKSEAGSGCG
SPAILVEEEINHSAKYPDLYPSNIRCHWFICAPEKHIIKLTFEDFAVKFSPNCIYDAVVI
YGDSEEKHKLAKLCGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFE
PKLPPQNNPVSTVKAILHDVCGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYQC
GGAIINPVWILTAAHCVQLKNNPLSWTIIAGDHDRNLKESTEQVRRAKHIIVHEDFNTLS
YDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEICAVTGWGSISADGGLASRLQQIQ
VHVLEREVCEHSYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCRHENGPFVLYG
IVSWGAGCVQPWKPGIFARVMIFLDWIQSKINGPASLQTNNKCKTLKQQLPPPAPSPDSA
SWPGCCSEAELEKPRGFFPTPRYLLDYKGRLECSWVLRVSPSSMAKFTIEYLSLLGSPVC
QDSVLIIYEERHSKRKTAGGLHGRRLYSMTFMSPGPLVRVTFHALVRGAFGISYIVLKVL
GPKDSKITRLSQSSNREHLVPCEDVLLTKPEGIMQIPRNSHRTTMGCQWRLVAPLNHIIQ
LNIINFPMKPTTFVCHGHLRVYEGFGPGKKLIGN
Download sequence
Identical sequences ENSGGOP00000022740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]