SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022742 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022742
Domain Number 1 Region: 199-377
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.08e-44
Family Reprolysin-like 0.00074
Further Details:      
 
Domain Number 2 Region: 403-471
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000000000864
Family Blood coagulation inhibitor (disintegrin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022742   Gene: ENSGGOG00000026088   Transcript: ENSGGOT00000027057
Sequence length 679
Comment pep:novel chromosome:gorGor3.1:4:198614468:198616976:-1 gene:ENSGGOG00000026088 transcript:ENSGGOT00000027057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVSEALVHVRFTHLLLCLGVFLFFSGWLQIGLCQHQSLPEVVIPLRITGADRGTDTQG
WLSYGLQFGSQRYIVHMKVNKLLIFLISKSFSVFTYSDQGAIFEDQFVQDDCYYHSYVEG
DPESLVALSSPGGFQGIPQEIKPKRLSATFEHLIYKMDNEETQFPPMRCGLIEEEIAGQL
KFQDPSTLMQSGFEGWWTHKLFVELAVVVDDESHTSNVQEEVLMLYQKANAFYIPLGAIV
TVVGLEIWTQENFITRDTAGVGLKEICKWKQTSFNSCIPHDVAHLIVKCSYGITLGLANV
GTVCYRKSNYAINSFGHNRVVSFALVVAPELGHNLGMTHDTKTCSCGKKCIMFPTATSTK
RFSNCSARFFQTTVTTICMHASPNRDRIMTQRCCGNGAVESAYDRGNLPSCKDPCCFANC
TFKPGAACVLGLCCKNCQIMPSVEVCRQESSECDLPEWFNGTSHECAEDVCLQDGIPCKG
SGHCYEKRCNNCDEQCRQIFGQVAKSANQSCCSNMNIRGDHFGHCGFVRCEVTDILCGRV
ECENMQEIPLLRDHSTLHRTHSIGVTCWDTDYRIGISTPDIGDVKDATECGSEHICMHRK
CVTMSLLNSTCLPVTCNMRAVCNNKHHRHCSREWKPPDCLREGTEGSVDSGTTTPRKKGE
NESNFSVLFVIKLDLGFLS
Download sequence
Identical sequences ENSGGOP00000022742 ENSGGOP00000022742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]