SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022766 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022766
Domain Number 1 Region: 536-600,638-736
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-30
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 2 Region: 1156-1289
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-19
Family Second domain of FERM 0.0046
Further Details:      
 
Domain Number 3 Region: 741-888
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000198
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022766
Domain Number - Region: 1058-1137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00022
Family First domain of FERM 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022766   Gene: ENSGGOG00000012607   Transcript: ENSGGOT00000032447
Sequence length 1433
Comment pep:known_by_projection chromosome:gorGor3.1:2a:44397336:44468753:1 gene:ENSGGOG00000012607 transcript:ENSGGOT00000032447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDIIQNLELQLEEQKQIRIQEAKI
IEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKL
SEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKELEFTEGKDMEEMEIPEKSVDNQV
LENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSGAPVSDWSSDEEDGSKGRSKSRC
TSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKA
LNSPLGKGNSELSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHPNS
LSGKGTQLVPSSHLPPPKLRIPNVFSVSVALAKKHLSQPQLSSDRMFGTNRNAISMIRPL
RPQETDLDLVDGDSTEVLENMDTSCDDGLFSYDSLDSPNSDDQENCDSAKKVACSKPPTP
PLHRFPSWESRIYAVAKSGIRMSEAFNMESVNKNSVATLSYTTSGLYTSLIYKNMTTPVY
TTLKGKATQISSSPFLDDSSGSEEEDSSRFSSRTSESDSRSRSGPGSPRAMKRGVSLSSV
ASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKSWKR
RWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTADSP
NILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYYFR
SQEDKVLTDQIRLIENLIKMDSTDHRRNKSEEWIHEQKSIITTGKVLRIYVNHYRPTSFF
AGMVHPLDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQ
QPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA
ALLSQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRL
STRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFLWLAVHEDGLSL
LEYNSMRLIVSYVYKSLMTFGGCQDDFMVVINNTHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKAAFHHLSAPALLSAQTRGPQARMMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences ENSGGOP00000022766 ENSGGOP00000012309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]