SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022783 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022783
Domain Number 1 Region: 1265-1407
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000114
Further Details:      
 
Domain Number 2 Region: 297-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.23e-37
Family PLC-like (P variant) 0.004
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.11e-25
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 4 Region: 1112-1261
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 23-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000568
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022783   Gene: ENSGGOG00000014860   Transcript: ENSGGOT00000026653
Sequence length 1409
Comment pep:known_by_projection chromosome:gorGor3.1:12:51066737:51081157:1 gene:ENSGGOG00000014860 transcript:ENSGGOT00000026653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRATSRPRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGISC
RVCKVATHRKCEAKVTSACQALPPVELRRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGNKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYISYFSGLLSGSIRMNSS
PLFLHYVLIPMLPAFEPGTGFQPFLKIYQSMQLVYTSGVYHIAGPGPQQLCISLEPALLL
KGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDERFPFQASVEF
VFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDSVDGSLTHTRGPLDG
SPYAQVQRPPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSRHCSCRQGYRE
PCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEGLYPYPPEMGK
PATGDFGYRTPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLEREAGEGWASE
AGKPLLHPVRPGHPLPLLLPACGHHHAPMPDYSCLKPPKAGEEGHEGCSYTMCPEGRYGH
PGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRAGSISPGSPPYPQ
SRKLSYEIPTEEGGDRYPLPGHLASAGPLASAESLEPVSWREGPSGHSTLPRSPRDAPCS
ASSELSGPSTPLHTSSPVQGKESTRRQDTRSPTSAPTQRLSPGEALPPVSQAGTGKAPEL
PSGSGPEPPVPSPVSPTFPPSSPSDWPQERSPGGHSDGASPRSPVPTTLPGLRHAPWQGP
RGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLP
GPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSNVKFVQDTSKFW
YKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVR
HFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAPVP
TNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSA
QGITLTDNQRKLFFRRHYPVNSITFSSTDPEDRRWTNPDGTTSKIFGFVAKKPGSPWENV
CHLFAELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences G3S3Y2
XP_004053251.1.27298 ENSGGOP00000022783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]