SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022826 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022826
Domain Number 1 Region: 653-791
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-34
Family WD40-repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 334-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000384
Family SPRY domain 0.006
Further Details:      
 
Domain Number 3 Region: 133-190
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000839
Family B-box zinc-binding domain 0.00089
Further Details:      
 
Domain Number 4 Region: 554-593
Classification Level Classification E-value
Superfamily F-box domain 0.000000916
Family F-box domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022826   Gene: ENSGGOG00000009625   Transcript: ENSGGOT00000029846
Sequence length 818
Comment pep:novel chromosome:gorGor3.1:17:16152037:16232320:-1 gene:ENSGGOG00000009625 transcript:ENSGGOT00000029846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGTEERQPRSRASQMAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVG
SSEKLGRETEEQDSDSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQ
PHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLD
AARRDKEVSVSEVKAVDEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYR
SAEMEKSKQELETMAAISNTVQFLEEYCKFKNTEDITFPSVYIGLKDKLSGHKVITESTV
HLIQLLENEYDIRTQVSAVVQRKYWTSKPEPSTREQFLQYAHDITFDPDTAHKYLRLQEE
NRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRVLLRFRRPSLGTGFCLVSLSDLL
PGFPQSLQPLPPFQGPPLQPQMKDGRKGLNQDITDVCFSPEKDHSSKSATSQVYWTAKTQ
HTSLPLSKAPENEHLLGAASNPEEPWRNSLRCISEMNRLFSGKGDITKPGYDPCNLLVDL
DDIRDLSSGFSKYRDFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSA
QGFIQNQITFLQGSYTRGIDPNYANNVSIPVPKMVDDGKSMRVKHPKWKLRTKYWDLKSG
VCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLNTFRHKDPILATRINDT
YIVSSCERGLVKVWHVAMAQLVKTLNGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKY
ERCLMAFKHPKLELNNQSKCLAHSQGSTALPCTSARSP
Download sequence
Identical sequences ENSGGOP00000009399 ENSGGOP00000022826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]