SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022829 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022829
Domain Number 1 Region: 24-130
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-22
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 450-556
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000152
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022829   Gene: ENSGGOG00000014162   Transcript: ENSGGOT00000032718
Sequence length 562
Comment pep:known_by_projection chromosome:gorGor3.1:4:2810793:2851982:1 gene:ENSGGOG00000014162 transcript:ENSGGOT00000032718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVY
YFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHVSKKHRTWFFSASSEDERK
SWMALLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPCPTDNEDYEHDDE
DDSYLEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPP
PKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRE
SASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKF
LKTAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPD
GQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGE
PQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYH
THVLPSHQSLLLRHPYGYTGPR
Download sequence
Identical sequences ENSGGOP00000022829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]