SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022837 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022837
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000729
Family Complement control module/SCR domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000681
Family Complement control module/SCR domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022837   Gene: ENSGGOG00000003527   Transcript: ENSGGOT00000032228
Sequence length 272
Comment pep:known_by_projection chromosome:gorGor3.1:10:6180517:6239846:-1 gene:ENSGGOG00000003527 transcript:ENSGGOT00000032228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEITHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
RPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGSAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQVQTEIAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Download sequence
Identical sequences G3S435
XP_004049075.1.27298 ENSGGOP00000022837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]