SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022849 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022849
Domain Number 1 Region: 35-254
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.41e-87
Family Fibrinogen C-terminal domain-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022849   Gene: ENSGGOG00000006049   Transcript: ENSGGOT00000028178
Sequence length 255
Comment pep:known_by_projection chromosome:gorGor3.1:5:60293504:60297228:1 gene:ENSGGOG00000006049 transcript:ENSGGOT00000028178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPS
GPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLL
TLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYH
SGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKG
FYYSLKRTEMKIRRA
Download sequence
Identical sequences A0A2J8J737 P55083
ENSP00000299610 9606.ENSP00000299610 ENSP00000299610 NP_002395.1.87134 NP_002395.1.92137 XP_003807320.1.60992 XP_004042181.1.27298 XP_016787736.1.37143 gi|23111005|ref|NP_002395.1| ENSGGOP00000022849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]