SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022896 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022896
Domain Number 1 Region: 384-425
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000765
Family LIM domain 0.015
Further Details:      
 
Domain Number 2 Region: 356-382
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000102
Family LIM domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022896   Gene: ENSGGOG00000004408   Transcript: ENSGGOT00000024253
Sequence length 426
Comment pep:novel chromosome:gorGor3.1:12:120050904:120109049:-1 gene:ENSGGOG00000004408 transcript:ENSGGOT00000024253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDGVGSPCSRVGEEEHVYSF
PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNQPGFPADEANSSPPLPGALSPL
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
QSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILD
Download sequence
Identical sequences ENSGGOP00000022896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]