SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022931 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022931
Domain Number 1 Region: 464-649
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 329-420
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000327
Family WWE domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022931
Domain Number - Region: 238-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00973
Family CCCH zinc finger 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022931   Gene: ENSGGOG00000026270   Transcript: ENSGGOT00000030310
Sequence length 657
Comment pep:known_by_projection chromosome:gorGor3.1:3:157395838:157428056:1 gene:ENSGGOG00000026270 transcript:ENSGGOT00000030310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQ
IPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPGHFQTDLLHPVSSDVPTSPDCLDK
VIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
Download sequence
Identical sequences G3RX27
ENSGGOP00000022931 XP_018880246.1.27298 XP_018880247.1.27298 XP_018880248.1.27298 XP_018880249.1.27298 XP_018880250.1.27298 ENSGGOP00000020362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]