SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022939 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022939
Domain Number 1 Region: 62-201
Classification Level Classification E-value
Superfamily L domain-like 1.98e-36
Family Ngr ectodomain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 274-537
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0000011
Family Putative isomerase YbhE 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022939   Gene: ENSGGOG00000023809   Transcript: ENSGGOT00000028619
Sequence length 545
Comment pep:known_by_projection chromosome:gorGor3.1:4:25106901:25147012:-1 gene:ENSGGOG00000023809 transcript:ENSGGOT00000028619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRRGGCGALGLLLLLLGAACLIPRSAQVRRLARCPATCSCTKESIICVGSSWVPRIVP
GDISSLSLVNGTFSEIKDRMFSHLPSLQLLLLNSNSFTIIRDDAFAGLFHLEYLFIEGNK
IETISRNAFRGLRDLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYL
WLKMTNSTVSDVLCIGPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKN
DVYVAIAQPSMENCMVLEWDHIEMNFRSYDNITGQSIVGCKAILIDDQVFVVVAQLFGGS
HIYKYDESWTKFVKFQDIEVSRISKPNDIELFQIDDETFFVIADSSKAGLSTVYKWNSKG
FYSYQSLHEWFRDTDAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDV
LAVKSFRMQNTLYLSLTRFIGDSRVMRWNSKQFVEIQALPSRGAMTLQPFSFKDNHYLAL
GSDYTFSQIYQWDKEKQLFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHII
VDLSL
Download sequence
Identical sequences A0A2J8NW18 G3S4D7 H2PD15 Q1EGL1 Q8N0V4
ENSPTRP00000027477 ENSGGOP00000022939 ENSP00000371548 ENSP00000371548 NP_001037843.1.37143 NP_060646.2.87134 NP_060646.2.92137 XP_002814689.1.23681 XP_004038547.1.27298 ENSP00000371548 ENSPPYP00000016362 ENSPTRP00000027477 gi|21313638|ref|NP_060646.2| 9598.ENSPTRP00000027477 9600.ENSPPYP00000016362 9606.ENSP00000371548 ENSPPYP00000016362 ENSGGOP00000022939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]