SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022955 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022955
Domain Number 1 Region: 58-260
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.38e-68
Family alpha-catenin/vinculin 0.00000000801
Further Details:      
 
Domain Number 2 Region: 508-631
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.67e-58
Family alpha-catenin/vinculin 0.00000053
Further Details:      
 
Domain Number 3 Region: 673-862
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.28e-56
Family alpha-catenin/vinculin 0.00027
Further Details:      
 
Domain Number 4 Region: 377-506
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.83e-47
Family alpha-catenin/vinculin 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022955   Gene: ENSGGOG00000012810   Transcript: ENSGGOT00000027723
Sequence length 906
Comment pep:known_by_projection chromosome:gorGor3.1:5:122308183:122489213:1 gene:ENSGGOG00000012810 transcript:ENSGGOT00000027723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
Download sequence
Identical sequences G3S4F3 H2QRK9
XP_003829253.1.60992 XP_004042639.1.27298 XP_009448018.1.37143 XP_016809389.1.37143 XP_018882395.1.27298 ENSPTRP00000029566 ENSGGOP00000022955 ENSPTRP00000029566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]