SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022996 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022996
Domain Number 1 Region: 446-501
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.22e-21
Family CCCH zinc finger 0.000029
Further Details:      
 
Domain Number 2 Region: 418-444
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000089
Family CCCH zinc finger 0.00041
Further Details:      
 
Domain Number 3 Region: 390-415
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000994
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022996   Gene: ENSGGOG00000013071   Transcript: ENSGGOT00000030548
Sequence length 1303
Comment pep:known_by_projection chromosome:gorGor3.1:19:44302144:44351610:-1 gene:ENSGGOG00000013071 transcript:ENSGGOT00000030548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAPGTPPPPPSESPPPPSPPPPSTPSPPPCSPDARPATPHLLHHRLPLPDDREDGELE
EGELEDDGAEETQDTSGGPERSRKEKGEKHHSDSDEEKSHRRLKRKRKKEREKEKRRSKK
RRKSKHKRHASSSDDFSDFSDDSDFSPSEKGHRKYREYSPPYAPSHQQYPPSHATPLPKK
AYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRRAKEGSSRGRGS
RGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGGDHPEDEEDFYEEEMDYGESEEPMGD
DDYDEYSKELNQYRRSKDSRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGGMNKGGMNDD
EDFYDEDMGDGGGGSYRSRDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIELPK
KRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDK
MLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPQAPTSPNGRPMQGG
PPPPPPPPPPPPGPPQMPMPVHEPLSPQQLQQQDMYNKKIPSLFEIVVRPTGQLAEKLGV
RFPGPGGPPGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPDMHPDMHPDMPMGPGMNP
GPPMGPGGPPMMPYGPGDSPHSGMMPPIPPAQNFYENFYQQQEGMEMEPGLLGDAEDYGH
YEELPGEPGEHLFPEHPLEPDSFSEGGPPGRPKPGAGVPDFLPSAQRALYLRIQQKQQEE
EERARRLAESSKQDRENEEGDTGNWYSSDEDEGGSSVTSILKTLRQQTSSRPPASVGELS
SSGLGDPRLQKGHPTGSRLADPRLSRDPRLTRHVEASGGSGPGDSGPSDPRLARALPTSK
PEGSLHSSPVGPSSSKGSGPPPTEEEEGERALREKAVNIPLDPLPGHPLRDPRSQLQQFS
HIKKDVTLSKPSFARTVLWNPEDLIPLPVPKQDVVPPVPAALQSMPTLDPRLHRAATAGP
PNARQRPGASTDSSTQGANLPDFELLSRILKTVNATGSSAAPGSSDKPSDPRVRKAPTDP
RLQKPTDSTASSRAAKPGPAEAPSPTASPSGDASPPATAPYDPRVLAAGGLGQGGGGGQS
SVLSGISLYDPRTPNAGGKATEPAADTGAQPKGAEGNGKSSASKAKEPPFVRKSALEQPE
TGKAGADGGTPTDRYNSYNRPRPKAAAAPAATTATPPPEGAPPQPGVHNLPVPTLFGTVK
QTPKTGSGSPFAGNSPAREGEQDAASLKDVFKGFDPTASPFCQ
Download sequence
Identical sequences G3S4J4
ENSGGOP00000012752 XP_018871354.1.27298 ENSGGOP00000022996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]