SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022998 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022998
Domain Number 1 Region: 144-478
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.01e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 483-612
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.78e-31
Family Ricin B-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022998   Gene: ENSGGOG00000028299   Transcript: ENSGGOT00000033637
Sequence length 615
Comment pep:known_by_projection chromosome:gorGor3.1:4:183855387:183932648:1 gene:ENSGGOG00000028299 transcript:ENSGGOT00000033637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRKNKAKNEQEHHAGGD
SQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEF
KQAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWST
LMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQ
ARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIP
QGGGDEDGYARGAWDWSMLWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFEL
GLYDPGLQIWGGENFEISYKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTL
KNYVRVVEVWWDEYKDYFYASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDIT
SHYPLPPKNVDWGEIRGFETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQY
DQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDS
SKTTQKWEMNNIHSV
Download sequence
Identical sequences G3S4J5
ENSGGOP00000022998 ENSGGOP00000022998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]