SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023016 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023016
Domain Number 1 Region: 297-691,772-777,808-850
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000599
Further Details:      
 
Domain Number 2 Region: 192-298
Classification Level Classification E-value
Superfamily Homeodomain-like 1.79e-30
Family SWIRM domain 0.00000121
Further Details:      
 
Domain Number 3 Region: 676-784
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023016   Gene: ENSGGOG00000003664   Transcript: ENSGGOT00000024772
Sequence length 873
Comment pep:known_by_projection chromosome:gorGor3.1:1:23793731:23870033:1 gene:ENSGGOG00000003664 transcript:ENSGGOT00000024772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGARLARAYATAVGGARVAGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERT
PRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVE
YREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQ
DDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQ
LWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTG
KVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG
NPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFN
VLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELH
QQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDV
YLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALA
EGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQF
VPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYK
APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARG
SYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL
REAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences ENSGGOP00000023016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]