SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023030 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023030
Domain Number 1 Region: 102-248
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.28e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00025
Further Details:      
 
Domain Number 2 Region: 2-68
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 9.94e-31
Family Hedgehog (development protein), N-terminal signaling domain 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023030   Gene: ENSGGOG00000010818   Transcript: ENSGGOT00000034537
Sequence length 310
Comment pep:known_by_projection chromosome:gorGor3.1:2b:108015752:108018257:-1 gene:ENSGGOG00000010818 transcript:ENSGGOT00000034537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRN
KYGLLARFQAPPGCQEAELHSSNTFMSLSPTEHSAAAKTGGCFPAGAQVRLESGARVALS
AVRPGDRVLAMGEDGSTTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTAD
NHTEPAARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVE
DVVASCFAAVADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSF
HPLGMSGAGS
Download sequence
Identical sequences ENSGGOP00000010547 ENSGGOP00000023030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]