SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023123 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023123
Domain Number 1 Region: 215-280
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000139
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 282-326
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000742
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023123
Domain Number - Region: 60-115
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0742
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023123   Gene: ENSGGOG00000010373   Transcript: ENSGGOT00000022424
Sequence length 633
Comment pep:known_by_projection chromosome:gorGor3.1:X:145743304:145773258:1 gene:ENSGGOG00000010373 transcript:ENSGGOT00000022424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REKPLKGRNIQNKFEQAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINE
SDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPA
TKDTFHKIKLDVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRA
HMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGANI
QQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNG
KLIQEIVDKSGVVRVRIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDNTSN
LSQMSQLVFWMFSLVLVASSVVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYHL
NYLKEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKSYVTDDGQGMGRGSRPYRNRGH
GRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERESFLRRGDGRRHSVVGLNR
GYGNKELPNILIGNDDHSRTDNRPRNPREAKGRTTDGSLQIRVDCNNERSVHTKTLQNTS
SEGSRLRTGKDRNQKKEKPDSVDGQQPLVNGVP
Download sequence
Identical sequences ENSGGOP00000023123 ENSGGOP00000010124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]