SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023163 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023163
Domain Number 1 Region: 277-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000182
Further Details:      
 
Domain Number 2 Region: 95-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 9-84
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023163   Gene: ENSGGOG00000028130   Transcript: ENSGGOT00000022277
Sequence length 356
Comment pep:known_by_projection chromosome:gorGor3.1:2a:71393786:71395272:1 gene:ENSGGOG00000028130 transcript:ENSGGOT00000022277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMT
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS
Download sequence
Identical sequences A0A096N6Z6 A0A0D9SDL0 A0A1S2ZLP8 A0A1S3FQ74 A0A250XZ20 A0A287CZR4 A0A2K5HLN2 A0A2K5KU00 A0A2K5PLU1 A0A2K5XUE3 A0A2K6AN92 A0A2K6GQR0 D2H0E6 F6V8I5 G1PPF8 G1SAQ4 G3HXL1 G3S509 G7NA92 G7PME6 H0VNW7 H2P5X9 H2QI21 L5KUI6 L9KMV5 M3WS36 O19048 P60335 Q15365 Q53SS8 Q5E9A3 S7PDZ8 U3DPC0 W5QE14
10090.ENSMUSP00000054863 10116.ENSRNOP00000023806 10141.ENSCPOP00000012166 9598.ENSPTRP00000020647 9600.ENSPPYP00000013749 9606.ENSP00000305556 9796.ENSECAP00000001771 9913.ENSBTAP00000049383 9986.ENSOCUP00000020092 ENSP00000305556 ENSP00000305556 ENSECAP00000001771 ENSNLEP00000022598 ENSMUSP00000054863 NP_001015565.1.59421 NP_001015565.1.76553 NP_001075593.1.1745 NP_001243850.1.31192 NP_006187.2.87134 NP_006187.2.92137 NP_035995.1.92730 XP_002757702.1.60252 XP_002799331.2.72884 XP_002811975.1.23681 XP_002914950.1.58354 XP_003262561.1.23891 XP_003469077.1.53824 XP_003508012.1.69978 XP_003793486.1.62490 XP_004005858.1.66739 XP_004029412.1.27298 XP_004277081.1.21590 XP_004324137.1.83887 XP_004398698.1.74151 XP_004435638.1.5094 XP_004609202.1.94378 XP_004668376.1.11716 XP_004691545.1.23501 XP_004710212.1.18182 XP_004742188.1.14098 XP_005322172.1.77405 XP_005364857.1.66349 XP_005575722.1.63531 XP_005686895.1.57651 XP_005867858.1.60319 XP_006079689.1.26621 XP_006093026.1.53796 XP_006151343.1.99106 XP_006728084.1.47382 XP_006775377.1.95426 XP_006909578.1.64745 XP_006984646.1.50099 XP_006998968.1.50099 XP_007083463.1.5354 XP_007113515.1.24612 XP_007175616.1.59432 XP_007453473.1.90284 XP_007521306.1.11023 XP_007938291.1.48129 XP_007968532.1.81039 XP_008145721.1.99482 XP_008145722.1.99482 XP_008513069.1.77740 XP_008574397.1.73410 XP_008698179.1.72690 XP_008821477.1.79516 XP_008843018.1.79516 XP_010843597.1.44457 XP_010962040.1.22495 XP_011279415.1.62641 XP_011363878.1.92234 XP_011711792.1.29376 XP_011800631.1.43180 XP_011840415.1.47321 XP_011895091.1.92194 XP_012000045.1.54773 XP_012501945.1.63892 XP_012605602.1.48125 XP_012878002.1.60039 XP_014692187.1.49734 XP_014919475.1.86478 XP_015335048.1.40921 XP_016016850.1.101085 XP_016058012.1.3490 XP_017377531.1.71028 XP_017504378.1.32401 XP_019296486.1.44245 XP_019503225.1.44202 XP_019574094.1.88060 XP_019826020.1.53367 XP_020022744.1.5219 XP_020733482.1.74333 XP_021045833.1.100879 XP_021490234.1.76796 XP_021554718.1.83697 XP_515530.2.37143 ENSBTAP00000049383 ENSCPOP00000012166 ENSECAP00000001771 ENSGGOP00000023163 ENSP00000305556 ENSGGOP00000023163 ENSNLEP00000022598 ENSMLUP00000012890 ENSPTRP00000020647 ENSRNOP00000023806 ENSOARP00000020962 ENSMUSP00000054863 ENSOCUP00000020092 ENSPPYP00000013749 ENSBTAP00000049383 ENSMLUP00000012890 ENSPTRP00000020647 ENSPANP00000008277 ENSCPOP00000012166 gi|222352151|ref|NP_006187.2| ENSOCUP00000020092 ENSMUSP00000054863 ENSPPYP00000013749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]