SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023204 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023204
Domain Number 1 Region: 1256-1418,1446-1525
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.61e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 723-949
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.37e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 71-229,326-393
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-33
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1591-1839
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023204
Domain Number - Region: 1527-1569
Classification Level Classification E-value
Superfamily PRTase-like 0.0303
Family Phosphoribosyltransferases (PRTases) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023204   Gene: ENSGGOG00000003386   Transcript: ENSGGOT00000028080
Sequence length 2358
Comment pep:known_by_projection chromosome:gorGor3.1:5:33387005:33453161:-1 gene:ENSGGOG00000003386 transcript:ENSGGOT00000028080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEEDGAGAEESGQPRSFMRLNDLSAEKDPGSADSEAEGLPYPALAPVVFFYLSQDSRP
RSWCLRTVCNPYTWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILHQAFDDFIFAF
FAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVRTVRVLRP
LRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENF
SLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGEGGGGPPCGLDYEAYNS
SSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIMYFVMDAH
SFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFS
EPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHR
RLSVHHLLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHA
DCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTL
TSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSGACGPESCPYCARAGAGEVE
LADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKI
VDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNIVFTSLFALEMLLKLLVYGP
FGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLM
KTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTLPDRKNFDSLLWAIVTVFQI
LTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLVAILVEGFQAEEISKREDAS
GQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCLALVSLGEHPELRKSLLPPL
IIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAAHEMKSPPSARSSPHSPWSA
ASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDEEESSEEERASPAGSDHR
HRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALQPDDPPL
DGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFPPQSRFRLLCHRIITHKMFD
HVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAVFLAEMTVKVVALGWCFGEQ
AYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGLK
LVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEAS
YRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFIS
FLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRRLEKKRRNLMLDDVIASG
SSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQIL
DEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEIEVNA
SLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFFIFAA
LGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKDTLRDCDQES
TCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELELEMKTLS
PQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPTDRQLFDTISLLI
QGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAEMEALSLTSEIVSEPSCSLA
LTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHGST
AEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPP
PGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQ
HSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPS
PRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPG
SRPKKKLSPPSITIDPPESQGPRPPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPK
KDVLSLSGLSSDPADLDP
Download sequence
Identical sequences ENSGGOP00000023204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]