SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023227 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023227
Domain Number - Region: 35-108
Classification Level Classification E-value
Superfamily STAT 0.00388
Family STAT 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023227   Gene: ENSGGOG00000024395   Transcript: ENSGGOT00000029699
Sequence length 163
Comment pep:known_by_projection chromosome:gorGor3.1:1:33338595:33340236:1 gene:ENSGGOG00000024395 transcript:ENSGGOT00000029699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQA
KPGPGGPGDICGFDSMDSALEWLRRELREMQAQDRQLAGQLLRLRAQLHRLKMDQACHLH
QELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC
Download sequence
Identical sequences G3S571 H2PYK2 Q9BTA0
ENSP00000362684 9598.ENSPTRP00000000839 9606.ENSP00000362684 ENSGGOP00000023227 ENSP00000362684 ENSPTRP00000000839 ENSPTRP00000000839 ENSGGOP00000023227 NP_116037.2.87134 NP_116037.2.92137 XP_001161749.1.37143 XP_003828197.1.60992 XP_004025415.1.27298 gi|110238585|ref|NP_116037.2| NYSGRC-110238585 ENSP00000362684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]