SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023229 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023229
Domain Number 1 Region: 85-418
Classification Level Classification E-value
Superfamily L domain-like 6.73e-36
Family Ngr ectodomain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023229   Gene: ENSGGOG00000025277   Transcript: ENSGGOT00000022473
Sequence length 484
Comment pep:novel chromosome:gorGor3.1:6:117952032:117969158:1 gene:ENSGGOG00000025277 transcript:ENSGGOT00000022473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLYAFFILLSLSNGFNPNCPGRCNCDSLRSAQCYRLTEVTSSIPSTIKRLYISHRKIH
HLQISGVNHVLALEDSILLASGTESVENDTLKTLSTLKTLELWKNKLVPSALSASLEVLK
LNDNSINVPHGSDFEGFKKLKILKLKNNLISSLSPSTFSTLVSLQSLMLDGNNVEATAGP
LILPHLTHMSLENNKLHLIQSLQFLSFSGNFLSKVPINLPKSLLSLKMERNHLRIVRFRH
LYLSENLLSSINGAQFLTNLTALELSQNQLQILPFRLPVKLQKLDCSNNLIQRVTAQDFQ
DLQDLKHLILENNASFFEAGALQRCSQLSNLALEQNLLLSIPLRLPGTLTRLDLKSSVIQ
NIAERELKDLKQLHVLNLRNNKISALDLKALEGLPHLRHLYLDGNPWNCTCSLLKAREVL
MAKGTDVRGGQCAAPTEQHGESWMSSKKIMRQCKHHFRLTEKSKETKKKSKPEDPSSIRI
NMED
Download sequence
Identical sequences ENSGGOP00000023229 ENSGGOP00000023229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]