SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023241 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023241
Domain Number - Region: 413-451
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000242
Family Erythroid transcription factor GATA-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023241   Gene: ENSGGOG00000005973   Transcript: ENSGGOT00000027826
Sequence length 634
Comment pep:known_by_projection chromosome:gorGor3.1:19:19768442:19891166:1 gene:ENSGGOG00000005973 transcript:ENSGGOT00000027826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPAQGL
LRATEATAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGL
TTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPT
GSVGSAVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASS
QVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNT
SLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSTESPASRQAAAKLALRKQLEKTL
LEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRMSAATVLSREPYMCAQ
CKTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQ
GAAPAQAKAEPTATPHPALKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPR
GVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSP
SLAVHKSSSAVERQREYLLDMIPPRSIPQSATWK
Download sequence
Identical sequences G3QT35
ENSGGOP00000023241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]