SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023255 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023255
Domain Number 1 Region: 24-130
Classification Level Classification E-value
Superfamily L domain-like 2.62e-25
Family Internalin LRR domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023255   Gene: ENSGGOG00000005702   Transcript: ENSGGOT00000027696
Sequence length 257
Comment pep:known_by_projection chromosome:gorGor3.1:21:32985343:32998217:-1 gene:ENSGGOG00000005702 transcript:ENSGGOT00000027696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLTRKMVLTRAKASELHSVRKLNCWWGSRLTDISICREMPSLEVITLSVNSISTLEPVS
RCQRLSELYLRRNRIPNLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQ
KLDNQAVTEEELSRALSEGEEITAAPEREGTGHGGPKPCCTLSSLSSAAETGRDPLDSEE
EATSGTQDERGLKPPSRGQFPSLSARDASSSHRGRNILTAILLLLRELDAEGLEAVQQTV
GSRLQALRGEEVQEHAE
Download sequence
Identical sequences ENSGGOP00000023255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]