SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023275 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023275
Domain Number 1 Region: 117-191
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000171
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 472-561
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000628
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 3 Region: 392-462
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000706
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023275
Domain Number - Region: 215-257
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00667
Family Cna protein B-type domain 0.0077
Further Details:      
 
Domain Number - Region: 331-372
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0844
Family Rhamnogalacturonase B, RhgB, middle domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023275   Gene: ENSGGOG00000022401   Transcript: ENSGGOT00000028314
Sequence length 776
Comment pep:novel chromosome:gorGor3.1:16:15427939:15494588:1 gene:ENSGGOG00000022401 transcript:ENSGGOT00000028314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKFAFFKVLPGDYEILATHPTWALKEPVFHVMGFSVT
GRVLNGPEGDGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFEMVTIK
IAPNTPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSEDKDKSLVTVETDAHGS
FCFKAKPGTYKVVMVPEAETRAGLTLKPQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLD
TCGDLLVTLQSLSRQGEKRSLQLSGKVNATTFTFDNVLPGKYKISIMHEDWCWKNKSLEV
EVLEDDVSAVEFRQTGYMLRCSLSHAITLIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNG
ILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNG
EPEQGVAVEAVGQNNCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPH
HRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSL
GQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLP
EQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGGVRALGQAASDNSGPEDAK
RQAKKQKTRRTLRLQEEFQLTWCLVPWRGTLGIHLFSSLPFASEILLETTATCIHY
Download sequence
Identical sequences ENSGGOP00000023275 ENSGGOP00000023275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]