SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023301 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023301
Domain Number 1 Region: 175-421
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 3.92e-81
Family Oxidoreductase molybdopterin-binding domain 0.00000000966
Further Details:      
 
Domain Number 2 Region: 424-545
Classification Level Classification E-value
Superfamily E set domains 3.85e-39
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.00000552
Further Details:      
 
Domain Number 3 Region: 85-167
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.84e-21
Family Cytochrome b5 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023301   Gene: ENSGGOG00000023990   Transcript: ENSGGOT00000033957
Sequence length 547
Comment pep:known_by_projection chromosome:gorGor3.1:12:54080517:54084081:1 gene:ENSGGOG00000023990 transcript:ENSGGOT00000033957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATMLLLHRAVVLRLQQACRLKSVPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVM
GTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLH
PGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYAD
DPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAP
GGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARL
CDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLP
RDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWDTVDFDSAP
SIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGE
EQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHR
VHVYVSP
Download sequence
Identical sequences ENSGGOP00000020486 ENSGGOP00000023301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]