SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023329 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023329
Domain Number 1 Region: 9-128,163-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-37
Family Nucleotide and nucleoside kinases 0.0000000914
Further Details:      
 
Domain Number 2 Region: 134-161
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 1.24e-18
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023329   Gene: ENSGGOG00000028122   Transcript: ENSGGOT00000034362
Sequence length 227
Comment pep:known_by_projection chromosome:gorGor3.1:9:4730180:4758980:-1 gene:ENSGGOG00000028122 transcript:ENSGGOT00000034362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFI
DQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEV
IKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQT
KPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Download sequence
Identical sequences G3S5H3 Q9UIJ7
NP_057366.2.87134 NP_057366.2.92137 XP_004047811.1.27298 ENSGGOP00000023329 gi|19923437|ref|NP_057366.2| gi|315434225|ref|NP_001186783.1| 9606.ENSP00000371230 ENSP00000371230 1zd8_A ENSP00000371230 ENSGGOP00000023329 cath|current|1zd8A00/6-217 ENSP00000352948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]