SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023367
Domain Number 1 Region: 916-1223
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.62e-83
Family Complement components 0.0000225
Further Details:      
 
Domain Number 2 Region: 1296-1426
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.19e-39
Family Alpha-macroglobulin receptor domain 0.00000232
Further Details:      
 
Domain Number 3 Region: 744-864
Classification Level Classification E-value
Superfamily E set domains 1.37e-28
Family SVA-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023367   Gene: ENSGGOG00000024493   Transcript: ENSGGOT00000033847
Sequence length 1431
Comment pep:novel chromosome:gorGor3.1:12:9465516:9510258:-1 gene:ENSGGOG00000024493 transcript:ENSGGOT00000033847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLVLVPSHLCTGVPEKTCVILNHLNETVALKVTLMYKMQKRSLLTDLVTKRNYFYCTSFM
IPELPSSWVVIAVEVEGATLHFTKSKSIYTTTAENLVFVQTDKPIYKPGQTVKFRVVSMD
VNFHPLDEMFPVVYIEDPRKNQIFQRQSLKLQGGLNQLSFPLSVEPILGSHKIMLQRESG
KKIQHSFEMNEYVLPKFEVQVTMPKVIGFLDEEFVITTCALYTYGEPVPGLVTLSVCRRY
SLCRSDCHNTCSRSICEEFSQQADTEGCFTQLVNTKIFQLRQKEYDMTIHVKAKVKEEGT
GLELTGHGSYEITDTLRILRFTKVDSHYRSGLPWYGQVLLVNENHQPITNKTVDVHVNTR
YYFSATTDDHGLVNTSMDTTNYISPFLTISVKYKESNNCSDNWWLDEFHTQTSHTAKHFF
SPSKNYIHLKPIIGTLTCGQTQEIQAHYILNKQILRDEKELTFYYLIKARGKISQSGIHV
LSIEQGNMKGVFSFSFRVESDSAPSAHLLVYTVLPNGEIGADTDKLEIENCFANKVNLRF
SSAQSLPASNTRLKVTATPLSLCALRAVDQSVLLMKPEAELSPKSVYNLLPVKSPFTFRA
GGPADEYDEECNNAKDATHSGITSTPKQVPEGDDIYSIFTSIGLDIFTNSKIHKPTLCLP
RGLRISIVGGKEFIRLLHHLRESYMKEIVRKYFPETWIWDLVVVDSALLFSAGDQVPETI
IEWKSRAFCLSGTTVFGLSPIVSLQAFQPFFLELTLPYSVVRGEAFTLKATVFNYLSTCI
RVVVQLEVSSAFLAVPTEKNEESHFVCRNGRKTVSWVVTPKSLGKVNFTATAEAMHSQEV
CDNELTDVPPLAQKDTVVKPLLVEPEGIAKEETFNTLLCASDTGVPEKVSLNVPSNVVEG
SPRATYSVLGDILGSVVQNLQNLLQMPCGCGEQNMVLFVPNIYVLNYLNETRQLTEKIKA
KATSYLISGYQRQLNYKHRDGSYSTFGDNDGSSQGNKLTAFVLKSFAQAQSYVSVESSHI
RDALTWLSQGQKADGFFKGSGSLLNNAIKGGVNDEVTFSAYITIALLEMPLPATHAVVCS
ALSCLETAWSSTSEAQGSAVYTKALLAYAFALAGNKVKRRELLESLNREAVKEEDSIHWQ
RPGKLHEAKILYSQPWAPSAEVEMTTYVLLTYLTVQPAPSSEDLSVASRIVKWITKQQNP
QGGFSSTQDTMVALQALSKYGTATFTKSEKAALVTIQSSDTFSKDFQVDDGNRLVLQEVR
LPEVPGEYSTTMSGSGCVYLQTCLRYNILPKKEGKTPFALQVNTLPTNCDGMDAHRTFQI
HINISYTGDRPSSNMVIVDVKMVSGFILMRASVKKLQKQPQIQRTEVSTNHVPIYFEKLT
HQTLHFSFFVEQDIQIKNLKPATVEAYDYYETDEFTFEEYNVPCSAGKGSS
Download sequence
Identical sequences ENSGGOP00000023367 ENSGGOP00000023367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]