SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023368 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023368
Domain Number 1 Region: 370-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000571
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 629-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000583
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 911-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000346
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023368
Domain Number - Region: 691-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000742
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 160-170
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023368   Gene: ENSGGOG00000009133   Transcript: ENSGGOT00000029870
Sequence length 1006
Comment pep:known_by_projection chromosome:gorGor3.1:14:2480458:2496674:-1 gene:ENSGGOG00000009133 transcript:ENSGGOT00000029870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQRKPQQLISDCEGPSASENGDASEEDHPQVCAKCCAQFTDPAEFLAHQNACSTDP
PVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEE
SSGHFLVAATGTAAGGGGGLILASPKLGATPLPPESTPAPPPPPPPPPPPGVGSGHLNIP
LILEELRVLQQRQIHQMQMTEQICRQVLLLGSLGQTVGAPASPSELPGTGTASSTKPLLP
LFSPIKPVQTSKTLASSSSSSSSSGAETPKQAFFHLYHPLGSQHPFSAGGVGRSHKPTPA
PSPALPGSTDQLIASPHLAFPSTTGLLAAQCLGAARGLEATASPGLLKPKNGSGELSYGE
VMGPLEKPGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGNLKVHFH
RHREKYPHVQMNPHPVPEHLDYVITSSGLPYGMSVPPEKAEEEAATPGGGVERKPLVAST
TALSATESLTLLSTSAGTATAPGLPAFNKFVLMKAVEPKNKADENTPPGSEGSAISGVAE
SSTATRMQLSKLVTSLPSWALLTNHFKSTGSFPFPYVLEPLGASPSETSKLQQLVEKIDR
QGAVAVTSTASGAPTTSAPAPSSSASSGPNQCVICLRVLSCPRALRLHYGQHGGERPFKC
KVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKFTNAVTLQQHVRMHLGGQIPNG
GTALPEGGGAAQENGSKQSTVSGAGSFPQQQSQQPSPEEELSEEEEEEDEEEEEDVTDED
SLAGRGSESGGEKAISVRGDSEEASGAEEEVGTVAAAATAGKEMDSNEKATQQSSLPPPP
PPDSLDQPQPMEQGSSDVLGGKEEGGKPERSSSPASALTPEGEGTSVTLVEELSLQEAMR
KEPGESSSRKACEVCGQAFPSQAALEEHQKTHPKEGPLFTCVFCRQGFLERATLKKHMLL
AHHQVQPFAPHGPQNIAALSLVPGCSPSITSTGLSPFPRKDDPTIP
Download sequence
Identical sequences G3S5L2
ENSGGOP00000023368 ENSGGOP00000008923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]