SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023381 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023381
Domain Number 1 Region: 457-744
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.54e-53
Family Eukaryotic proteases 0.0000275
Further Details:      
 
Domain Number 2 Region: 188-453
Classification Level Classification E-value
Superfamily vWA-like 6.5e-39
Family Integrin A (or I) domain 0.0000477
Further Details:      
 
Domain Number 3 Region: 84-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 5 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000528
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023381   Gene: ENSGGOG00000002254   Transcript: ENSGGOT00000022133
Sequence length 751
Comment pep:novel chromosome:gorGor3.1:6:32825214:32848816:1 gene:ENSGGOG00000002254 transcript:ENSGGOT00000022133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLMVLFCLLFVYTGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRHCCPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
KPKVLMSVLNDNSRDMTEVISSLENANYKAHESGSSSDSHASVSQVEFLWLKQLLCLSLQ
SSWDYSREFFILFVLGKSNMGGSPKTAVDRIREILNINQKRNDYLDIYAIGVGKLDVDWR
ELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWH
VTIKPKSQETCRGALISDQWVLTAAHCFRDGKDHSLWRVNVGDPKSQWGKEFLIEKAVIS
PGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTCR
DHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTD
QFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSK
VPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
Download sequence
Identical sequences ENSGGOP00000023381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]