SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023391 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023391
Domain Number 1 Region: 193-396
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.00000161
Further Details:      
 
Domain Number 2 Region: 2-218
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-36
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 383-549
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-33
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 4 Region: 667-768,845-871
Classification Level Classification E-value
Superfamily SH2 domain 1.38e-25
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 5 Region: 794-873
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 582-661
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023391   Gene: ENSGGOG00000007911   Transcript: ENSGGOT00000023305
Sequence length 877
Comment pep:known_by_projection chromosome:gorGor3.1:9:117400183:117623601:-1 gene:ENSGGOG00000007911 transcript:ENSGGOT00000023305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
VQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMVSPAPKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKVGPSWSYGFYL
IHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACK
MFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFMSLSSQDASGAGPGPKMVAVQNYHGTP
APPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRP
PSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIK
VVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRS
PASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGD
VVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSGGOP00000023391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]