SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023401 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023401
Domain Number 1 Region: 225-292
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000105
Family Splicing factor U2AF subunits 0.041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023401
Domain Number - Region: 156-181
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000327
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 291-319
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000733
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023401   Gene: ENSGGOG00000011962   Transcript: ENSGGOT00000028649
Sequence length 465
Comment pep:known_by_projection chromosome:gorGor3.1:X:15756937:15786031:1 gene:ENSGGOG00000011962 transcript:ENSGGOT00000028649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEE
EKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKERE
EEEQKRQEKKEKELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNF
PTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKV
IQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICG
LFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDY
YSRLRGRRNPSPDHSYKRNGESERKRSSHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDR
SRGRGSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Download sequence
Identical sequences ENSGGOP00000023401 ENSGGOP00000023401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]