SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023433 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023433
Domain Number 1 Region: 345-694
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.02e-88
Family YicI catalytic domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 71-160,213-343
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000148
Family YicI N-terminal domain-like 0.009
Further Details:      
 
Domain Number 3 Region: 717-790
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000863
Family Putative glucosidase YicI, domain 3 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023433   Gene: ENSGGOG00000010835   Transcript: ENSGGOT00000022241
Sequence length 929
Comment pep:known_by_projection chromosome:gorGor3.1:15:20994287:21076695:1 gene:ENSGGOG00000010835 transcript:ENSGGOT00000022241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCRITANPFKVDLVSGEEVVISINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQQQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLK
NTGDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEP
AVEYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMP
PLFSLGYHQCRWNYEDEEDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNP
KRMQELLRSKKRKAAIIIKEHWPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGL
SSYLDFTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNW
EHRELHNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNL
KISIPMLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREP
WLFGEEHTQLIREAIRERYGLLPYWYSLFYYAHVASQPVMRLRLESYEKESWLSGTFPFP
LNSYKTENLHYLGSALLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVA
LDTIPVFQRGGSVIPIKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLH
QKQFLHRKFSFCSSVLINSSADQRGHYPSKCVVEKILVLGFRKEPSSVTTHSSDGKDQPV
AFTYCAKTSTLSLEKLSLTIDTDWEVRII
Download sequence
Identical sequences ENSGGOP00000023433 ENSGGOP00000010571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]