SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023457 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023457
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.63e-18
Family Nuclear receptor ligand-binding domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023457   Gene: ENSGGOG00000026981   Transcript: ENSGGOT00000024985
Sequence length 103
Comment pep:novel chromosome:gorGor3.1:5:126950144:126950988:1 gene:ENSGGOG00000026981 transcript:ENSGGOT00000024985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLN
YCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Download sequence
Identical sequences ENSGGOP00000023457 ENSGGOP00000023457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]